RetrogeneDB ID:
retro_trub_12
Organism:
Location:
scaffold_261:132535-133105 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
53.78 %
Coverage:
61.98 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RAC3
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_trub_12
ATGTCTATTAAGTGTGTCCTTGTTGGGGACAACGCTGTGGGAAAGACGGCACTGCTGGTA
CGCTTCACCTCAGAGACCTTCCCGGAGTCCTACAGGCCCACGGTGTTTGATAATACAGGG
GTGGAGGTGTACATGGATGGTGTCCACATCAGCCTGGGACTGTGGGACACAGCGGGCAAT
GACACCTTTCAACAGATCCGACCCAGATCCTACCAGCAGGCGGACATCGTTCTCATCTGT
TACTCTGTGGCTAACCCGAACTCACTGGCCAATGTCCACAAAAAGTGGCTCCCTGAGGTT
CGGGAGCACCTGCCCAATGTTCCTGTTCTGGTTGTGGCCACACAAACGGACCTGCGGGAA
ATGGGGGCCTATCGGGGCAACTGCACCACATCAGCGGAGGGGGCACAAATGGCTCGTGAA
ATTAAAGCCAAAGGCTACGTGGAATGTTCTGCCTTTAGCAACCGCGGCGTCCAGCAGGTG
TTTGAGTACGCCGTGCGAATTGTTGTCAACCAGGCCAAAAAACAGGCCCGACGGCGGATG
TTCCGCATAAACCAGTGCAAAGTCTTTTGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVR
.IKCV.VGD.AVGKT.LL...T...FP..Y.PTVFDN....V..DG....LGLWDTAG.......RP.SY.Q.D..LIC.S...P.S..NV..KW.PEVR
Retrocopy
SIKCVLVGDNAVGKTALLVRFTSETFPESYRPTVFDNTGVEVYMDGVHISLGLWDTAGNDTFQQIRPRSYQQADIVLICYSVANPNSLANVHKKWLPEVR


Parental protein
HHCPNTPIILVGTKLDLRD
.H.PN.P...V.T..DLR.
Retrocopy
EHLPNVPVLVVATQTDLRE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide