RetrogeneDB ID:
retro_trub_13
Organism:
Location:
scaffold_15:928301-930632 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.9 %
Coverage:
61.06 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
elfn1b
Parental gene aliases:
No gene alias available
Parental gene description:
extracellular leucine-rich repeat and fibronectin type III domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-080327-21]

Genomic region (view in browser)





>retro_trub_13
GTGATGAGTGCCTTGTTTTGGTCTGTAGCCATTGTTTATTTGACTCAGATTGGCAGAGTG
AGTGCAGACTGCTGGTTAATCGAGGGTGAAAAGGGCTTTGTATGGCTTGCAATCTGTAGC
CAAAACCAACCACCTTACGAGGCCATCCCTCAGCATATCAACAGCACCATTGTGGACCTT
CGTCTGAATGAAAACAAAATCAAAAGTATTCACTATTCTGCCCTTAGCCGCTTTGCCAAC
TTAACCTACCTAAACCTGACGAAGAATGAAATCTCCTACATCGAGGACGGGGCCTTTTCT
GCTCAGTTTAACCTACAAGTCCTTCAAATGGGCTTCAACAAGTTGAGAAACTTGACCGAA
GGCATCCTCAGGGGTTTGGGAAAGCTGCAGTACCTCTACCTCCAGGCAAATTTGATTGAG
ACTGTGACACCTAATGCCTTTTGGGAATGCCCCAACATTGAGAACATTGACCTCTCCATG
AACCGAATCCAGCAGTTAGATGGGTCCACATTCACCAGTTTGGCCAAACTGACCACCTGC
GAGCTGTACACCAATCCTTTTAACTGCTCCTGCGAGCTACTTGGATTTGTCAAATGGCTG
TCGGTCTTCCCCAACAGAACAAACGAGCGGATGGTGTGCGACTCCCCATCTGGTGTCTCT
GGTTATAGTTTACTCAGCCAGAATCCAAACAACCCAACATACAAAAATGCTCTTTATATG
CTCACCACCGTGTGTACTGATGACTACGTCACACCGTACACGCCAATCCCCACTGAGTCC
ATCACGCCCCCGCCAGACTCAACACTGTGCGGTCTGGAGGATTGTCCCTCGGGGACAGAG
CCGGAGGAGATCATCATCAGTACAACATATAACGATGTGGAGGTAAACCCTGTCTTGAAG
CTGAAACAGGTTACAAATACAGGCGCTACTATTACAGTTCAGATTCCGTATCCCTTCAAG
AAGATGTACATCCTGGTTCTGTACAACAACAGCTTTTTCACGGACATTCAAAACCTGAAC
AAAATAAAGGATGACATTGAGCTGAAAAATCTCAATCCCCACACTAACTACACGTACTGT
GTGGCTTCCATACGCAACTCCCTTCGCCATAATCACACTTGTCTGACAATCACCACCGGC
ACCCGGAATGGGAAGGAAAGAAGCGTAAACAATGCAACTGCTACCCACTACATCATGACC
ATTTTAGGCTGCCTCTTCAGCATGGTCATCTTCCTCGGAGTTGTCTACTATTGTTTGCGG
AGAAAGCGGCAACAAGATGAAAAGCACAAAAAGTCAGGTAGCTTAAAGAAGAACATAATG
GAGCTGAAATATGGACAGGAACTGGAAGGGGGGAATATTTCTCGCATGTCACAGAAGCAG
TTGTTGGCTGGGGACAGCATGGCACGCATGCCGTACCTACCACCTGCTGCCGAGATGGAG
CAGTACAAATTTCAAGAGATAGGTGACACCCCTAAAATGATGAAAGGGAACTACATGGAG
GTGCGGAGCATGGACCACCACGACCGCAGGGAGTGCGAAATGGGAATGGCGGGGAATAGC
CAGGGGTCGGTGGCCGAGATTTCCACCATAGCAAAAGAGGTGGATAAAGTAAATCAGATT
ATTAACAACTGCATAGATGCGCTGAAGTCTGAATCCACCTCTTTTCAGGGCATGAAATCT
GGAGCGGTGTCCACCGCAGAGCCTCAGCTGGTGCTGATATCAGAGCACCCACAAGGTAAA
CCTGGCCTTCTGTCCCCCGCATATCAGGACAGCTACCACCACTCTCTGCAGAGGCATCGC
TCGTCTGACATCTCGCCAAAGAGGCCCAGCACTGCCACAGGAGGTCCAATGCGAAGCCCC
AGGCCTTACCGCTCTGAATCCAAGTACATCGAGAAAACCTCCCCGACGGGAGAGACCATC
GTCACTGTAACGCCCACTGCAGCCATCCTGAGGGCTGAGGCGGACAAGATCCGCCAGTAC
AGCGACCATCGACACTCGTATCCCGACGCTCAGATTGAGGAGCTTGAAGGACCTGATGGC
CACAAGTCATCCTTGTTAGAGCCTCTCACCCATTCCCGTTCCAGAGACTTAGCGTACTCC
CAACTGCCTTCCCAGTATCAAAATCTGAGCTACTCCTCCAGCCCCGAGTACTACTGCAAA
CCGCCACAGAGCATCTGGGGGCGATTCAAACTGCACCGGAAGCGGCACAAAGACGACGAG
TACATGGCTGCCGGCCACGCGCTGCGGAAGAAGGTCCAGTTTGCGAAGGACGAGGATCTG
CACGACATTTTAGACTACTGGAAAGGTGTTTCAGCCCAGCATAAATCATAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VLSTFLCWLVVLSVMRLPVVTADCWLIEGEKGFVWLAICSMNQPPYESIPAHINSTIVDLRLNENKIRSVHYSSLSRFGNLTYLNLTKNDISYVEDGAFS
V.S................V.ADCWLIEGEKGFVWLAICS.NQPPYE.IP.HINSTIVDLRLNENKI.S.HYS.LSRF.NLTYLNLTKN.ISY.EDGAFS
Retrocopy
VMSALFWSVAIVYLTQIGRVSADCWLIEGEKGFVWLAICSQNQPPYEAIPQHINSTIVDLRLNENKIKSIHYSALSRFANLTYLNLTKNEISYIEDGAFS


Parental protein
AQFNLQVLQMGFNKLRNLTEGMLRGLGKLQYLYLQANLIETVTPNTFWECPNIENIDLSMNKIQVLDGSLFSGLSKLTTCELYTNPFNCSCELLGFLRWL
AQFNLQVLQMGFNKLRNLTEG.LRGLGKLQYLYLQANLIETVTPN.FWECPNIENIDLSMN.IQ.LDGS.F..L.KLTTCELYTNPFNCSCELLGF..WL
Retrocopy
AQFNLQVLQMGFNKLRNLTEGILRGLGKLQYLYLQANLIETVTPNAFWECPNIENIDLSMNRIQQLDGSTFTSLAKLTTCELYTNPFNCSCELLGFVKWL


Parental protein
STFPNRTSERMVCDSPQGFFGYSLLSQNLRMSSQGNALHMLSVVCTDVDSSVTSFNGIGMVDFTTMLPDFASPCGLDDCASGTPPDEVINFSPIFSD--T
S.FPNRT.ERMVCDSP.G..GYSLLSQN.......NAL.ML..VCT..D..VT....I.....T...P.....CGL.DC.SGT.P.E.I..S....D...
Retrocopy
SVFPNRTNERMVCDSPSGVSGYSLLSQNPNNPTYKNALYMLTTVCT--DDYVTPYTPIPTESITP--PPDSTLCGLEDCPSGTEPEEII-ISTTYNDVEV


Parental protein
NPIMTLKQVQHSSAVITVQLPHPYKKMYILALYNNSFFMDIQNLRRQREDIELKNLKPNTNYTYCVASIRNSLRFNHTCLTISTGRQSGVERAVNKSSAT
NP...LKQV....A.ITVQ.P.P.KKMYIL.LYNNSFF.DIQNL.....DIELKNL.P.TNYTYCVASIRNSLR.NHTCLTI.TG...G.ER.VN...AT
Retrocopy
NPVLKLKQVTNTGATITVQIPYPFKKMYILVLYNNSFFTDIQNLNKIKDDIELKNLNPHTNYTYCVASIRNSLRHNHTCLTITTGTRNGKERSVNNATAT


Parental protein
HYIMTILGCLFGMLLFLGLIVHCLRKRRLMEEKERKMSRIQRTLIELKYGGDDDIEGGGVGPVSQK-LSAGDSLSRIPYLPQGGEIDPYKLQEVIETPPH
HYIMTILGCLF.M..FLG....CLR..R...EK..K.........ELKYG.....EGG.....SQK.L.AGDS..R.PYLP...E...YK.QE...TP..
Retrocopy
HYIMTILGCLFSMVIFLGVVYYCLRRKRQQDEKHKKSGSLKKNIMELKYG--QELEGGNISRMSQKQLLAGDSMARMPYLPPAAEMEQYKFQEIGDTP--


Parental protein
KPAKPNYMEVRGSGIERERERE
K..K.NYMEVR.......RE.E
Retrocopy
KMMKGNYMEVRSMDHHDRRECE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide