RetrogeneDB ID:
retro_trub_17
Organism:
Location:
scaffold_7:2701017-2702097 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.16 %
Coverage:
88.98 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
NPY8AR
Parental gene aliases:
No gene alias available
Parental gene description:
neuropeptide Y/peptide YY receptor [Source:RefSeq peptide;Acc:NP_001098073]

Genomic region (view in browser)





>retro_trub_17
GTCATGGAGCCGCAGCTCAACAACCAGGCCCCGTGGAAGGAATTCCCGTGGGACTTCACG
GATGACTGCTCGCTGTCGGTGGGGGGCACCACCTTCCTCATCGTCGCTTACAGCGCCGTC
ATGGCGGTCGGACTCATCGGCAACTCGTGCCTGGTGTTCATCATCTTGCGGCACAAGGAG
ATGCGCAACGTCACCAACATCTTCATCGTCAACCTGTCCTGCTCCGACATCCTCATGGGC
GTCGTTTGCCTGCCGGTCACCATCATCTACACGCTGATGGACCGCTGGATCCTGGGCGAT
GCTCTGTGTAAGATCACGCCCTTCGTCCAGTGCATGTCCGTGTCCGTGTCCATCTTCTCC
CTGGTCCTCATCACCATGGAGCGCTACCAACTCATCATCCACCCCACCGGATGGAAGCCC
GTGCTGGGCCAGTCCTACCTGGCCGTGGCCGTCACCTGGATCGTGGCGTGTCTCATCTCC
GTGCCTTTTCTCTCGTACAGCGTGCTCACCCTGCCCTTCCAGAACCTGAGCGTCCCCTTC
CCCATCAGCGACCATCTCATCTGCATGGAGCGCTGGCCCTCGGTTCAGGAACGGCGAGCC
TACACCACCTCCCTGCTGGTCTTCCAGTACTTCCTGCCGCTGGTGCTCATCACCGTTTGC
TACCTGCACATCTACCTGCGTCTCAGGAGGCGGAAGGACATAGTGGATCGTGGTCGGAAC
GGCGCCCAGAAGAGAAACAGGGGCTCCGCGAGGATCAACGCCATGCTGGTTTCCATCGTG
GTGGCGTTCGCTGTCTCCTGGCTGCCACTAAACATCTTCAACACCGTGTTCGACTGGCAC
CACGAGGCCATCCCCTCCTGCGGCCACGACATCATTTTCTCCTTCTGCCACCTCGCCGCC
ATGGCGTCCACCTGCATCAACCCCGTCATCTACGGCTTCCTCAACAGCAACTTCCAGAAG
CAGCTCAAGTCGACGCTGCTGCGCTGCCGCTGCTGGGGCGCGGTCGAGCGGTACGAGAGC
GTCCCGCTGTCCACGGTCAGCACCGAGGTCACCAAGGGGTCGATCCTCAGCAACGGATCT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
WEGSDWAETSQCPPSIGGATFWIVAYSAIIAIGLLGNAGLVFIIARQQELRNVTNILIANLSCSDILMCVVCLPVTVIYTLMDRWVLGEALCKVTPFVQC
W....W..T..C..S.GG.TF.IVAYSA..A.GL.GN..LVFII.R..E.RNVTNI.I.NLSCSDILM.VVCLPVT.IYTLMDRW.LG.ALCK.TPFVQC
Retrocopy
WKEFPWDFTDDCSLSVGGTTFLIVAYSAVMAVGLIGNSCLVFIILRHKEMRNVTNIFIVNLSCSDILMGVVCLPVTIIYTLMDRWILGDALCKITPFVQC


Parental protein
MSVTVSIFSLVLIALERHQLILHPTGWSPAAGHSYLAVGLTWLVACFISLPFLSFNVLTNDPFQNISLPANPFRDHLICMEKWPSNKHRLAYMTSLLVFQ
MSV.VSIFSLVLI..ER.QLI.HPTGW.P..G.SYLAV..TW.VAC.IS.PFLS..VLT..PFQN.S.P..P..DHLICME.WPS...R.AY.TSLLVFQ
Retrocopy
MSVSVSIFSLVLITMERYQLIIHPTGWKPVLGQSYLAVAVTWIVACLISVPFLSYSVLTL-PFQNLSVPF-PISDHLICMERWPSVQERRAYTTSLLVFQ


Parental protein
YCLPLVLVLLCYLRIFLRLKRRRSQRDMLERSRRTR--GAQRINVMLLAIVVAFALCWLPLNVFNTLFDWHHQVLPDCQHDAIFSACHLTAMASTCINPV
Y.LPLVL...CYL.I.LRL.RR....D........R..G..RIN.ML..IVVAFA..WLPLN.FNT.FDWHH...P.C.HD.IFS.CHL.AMASTCINPV
Retrocopy
YFLPLVLITVCYLHIYLRLRRRKDIVDRGRNGAQKRNRGSARINAMLVSIVVAFAVSWLPLNIFNTVFDWHHEAIPSCGHDIIFSFCHLAAMASTCINPV


Parental protein
VYGFLNSNFQKELKATLQRCQCSNRTTESYESFPLSTVGSE
.YGFLNSNFQK.LK.TL.RC.C.....E.YES.PLSTV..E
Retrocopy
IYGFLNSNFQKQLKSTLLRCRCWG-AVERYESVPLSTVSTE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide