RetrogeneDB ID:
retro_trub_23
Organism:
Location:
scaffold_1215:34243-34594 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
52.99 %
Coverage:
71.78 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
TKT (1 of 3)
Parental gene aliases:
No gene alias available
Parental gene description:
transketolase [Source:HGNC Symbol;Acc:11834]

Genomic region (view in browser)





>retro_trub_23
CAAGAGCAACTACACCAATGGCATGAATTAGCGCAACAATTGCGAATAGATAGTATTCGC
GCCACAACCGTCGCTGGTTCAGGCCACCCCACTTCTTCCATGTCCTCTGCCGATTTAATG
GCGGTGTTATTAACTAATTATCTTCACTACGATTTTGACAATCCACATCACCCTAATAAC
GATCGCTTTATTCTCTCTAAAGGACACGCTGCACCCTTACTTTACGCCATGTATAAAGCG
GCTGGGGTCATCACCGATGAGGAATTAATGTCATTGCGGCAAATGGGTAGCCGTCTGGAA
GGTCATCCCACCCCAGTATTACCTTGGGTGGATGTGGCGACTGGTTCCTTA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QQTLQALKNIATRLRINSIKATTAAGSGHPTSCCSVAEIMSVLFFHTMKYRPEDPRHSSNDRFVLSKGHAAPVLYAVWAETGYLKENELLNLRKVDSILE
Q..L......A..LRI.SI.ATT.AGSGHPTS..S.A..M.VL......Y....P.H..NDRF.LSKGHAAP.LYA.....G.....EL..LR...S.LE
Retrocopy
QEQLHQWHELAQQLRIDSIRATTVAGSGHPTSSMSSADLMAVLLTNYLHYDFDNPHHPNNDRFILSKGHAAPLLYAMYKAAGVITDEELMSLRQMGSRLE


Parental protein
GHPVPKQQFVDVATGSL
GHP.P....VDVATGSL
Retrocopy
GHPTPVLPWVDVATGSL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide