RetrogeneDB ID:
retro_trub_25
Organism:
Location:
scaffold_154:414165-414426 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
94.25 %
Coverage:
92.55 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
sumo3a
Parental gene aliases:
No gene alias available
Parental gene description:
SMT3 suppressor of mif two 3 homolog 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2133]

Genomic region (view in browser)





>retro_trub_25
AAAGGAGGGAGTCAAGAGAATGATCACATCAACCTCAAGGTTGCAGGGCAGGATGGTTCT
GTGGTTCAGTTCAAAATCAAAAGGCACACACCCCTCAACAAACTCATGAAGGCTTACTGT
GAACGACAGGGCCTTCAGATAAGGCAGATCAGATTCAGGTTTGATGGCCAGCCTATCAAC
GAGACAGATACACCTGCACAGCTGGAGATGGAAGATGAAGACACCATAGATGTATTCCAG
CAGCAGACAGAAGGTCGCTGC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EGVKTENDHINLKVAGQDGSVVQFKIKRHTPLNKLMKAYCERQGLQIRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGRC
.G...ENDHINLKVAGQDGSVVQFKIKRHTPLNKLMKAYCERQGLQIRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQT.GRC
Retrocopy
KGGSQENDHINLKVAGQDGSVVQFKIKRHTPLNKLMKAYCERQGLQIRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTEGRC


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide