RetrogeneDB ID:
retro_trub_26
Organism:
Location:
scaffold_178:451531-451834 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
87.13 %
Coverage:
95.28 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
PCBD1
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_trub_26
AGCAGTAAAATCCTGAGTCTGATAGAGAAGGAGAGGGCCCATCTGCTGCCTCCGCTACAC
AATGCTCAGTGGGTGGAGGTTGTGGGCTGAGATGCCATTTACAAAGAATTCATTTCTAAA
GACTTCAACCAGGCCTTTGGTTTCATGTCCAGAGTAGCCCTACAAGCAGAAAAGATGGAC
CATCACCCTGAGTGGTTCAATGTCTACAATAAGGTCCAGATCACTCTCAGCGCTCACGAA
TGTGGGGGGTTATCCCAGCGCGATATCGCCATGGCTAGCTTTATGGATCAGGCGTCACTG
ATG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AGKIQSLTEEERAHLLPLLHNAQWVEVVGRDAIYKEFIFKDFNQAFGFMSRVALQAEKMDHHPEWFNVYNKVQITLSTHDCGGLSQRDITMATFMDQASL
..KI.SL.E.ERAHLLP.LHNAQWVEVVG.DAIYKEFI.KDFNQAFGFMSRVALQAEKMDHHPEWFNVYNKVQITLS.H.CGGLSQRDI.MA.FMDQASL
Retrocopy
SSKILSLIEKERAHLLPPLHNAQWVEVVG*DAIYKEFISKDFNQAFGFMSRVALQAEKMDHHPEWFNVYNKVQITLSAHECGGLSQRDIAMASFMDQASL


Parental protein
I
.
Retrocopy
M


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide