RetrogeneDB ID:
retro_trub_29
Organism:
Location:
scaffold_190:474258-475458 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
69.21 %
Coverage:
76.75 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
TCTN1
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_trub_29
GAACGTGGTGTTCAGATGTCCTCCGCAGAAGGCTCGGCCTTCTCTGGATATCAGTATGGG
GATATAATGGTGACCATAGGAGAGAGGGGAGAGAGGGGGCGGCTCTGGCTGCCGAGCCCT
GGTGTGAGCGCTCACTGTGTGGACACCAATCCTGCAGCTTTCCTAGTGGAACAGAGGAGT
CGGTGTTCCAGACATTTGGACCTGAGGAAAGACTGCAGCACTCTGCCAACCCTCAACATG
GCATCCTTCACCAGTATTCAAATGTTAGCTGGACGGATTGACAATGCCTCAGTGGTTCCC
ATGGAGGTAACTTCAGTCATCCTCCAGTCTGTGGAAGGGCCTCAGTCTGAGCTACAGGTG
ACTGCTGGAGAAAATCTCCGCCCCAGACTCCTGAATCAAACTCTCTGCAGTAATGTGGTG
CTAAAGGCGGTCTATGTGGTTAAATATACCCCAGCTGGGAAAATTGTGAATGTGATGCTG
TCTCTGGTGATCGGGTTTATCCACGAAGCAGCGCTACCATTACTGCAGGAGTTTCAAATA
GCATTTGTTCAGGATGAGGCGACTGTCCACTACAGTGGGAATCCCGGATATGCGGTGGGA
CTTCCTCTTGTGTCTGGAACCATGACAGCAGATGGGATTACTAGAAGCATCAATCCCAGA
GACACCATGTCTGTACTGTATAGTGCTGCAGACCAGGACTGTCTCAGGAACCCACATCAG
CGTTCACCCATCCTGTTCGGTGTTGACTTTGTGTCTGGCTGCACATTAAGATTGGAGGAA
AATGTCAACTGTTCTCTTGTCTCGCAAACTATGTTAAGAGTTCTGAGAGGATCAAATTAT
CCCCAGTATGTAGCTTCCTCTGGAAACTCCCCATTAGATGCTCCCCAAGACTGGCTGCCA
ATCAGGAGCAACTTCCATCCTGGGGGAATACAGGGTTGCAGCATCCCTGTGTCATTTCAT
CTGGAAATGAAGTGGACCAAATATGGGTCTCTGGTGAACCCCCAGGCTCAGCTTGTGAGC
ATCCAGGAAATAATACAAACCGGCAACAGCAGTTTGGCCTTGTTATCCGGAGGCACCAAC
ATCGTGCTAGTCAGCATCTCAGTGTCTTTTGTAGCTGTCAGTGCTGGTGCTTCACCTGTT
TACAGAGCAAAGCCCACTGTCGATGCAACACTACCTTCTAACTTCTTTTACCCTTTAGTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ENGGQVSTSEDPAFSGYRYGDVLGTREESGERGRLWLPAPSVSARCVDTNPAAFLMDQSSRCTRPVVLESDCSTLPTLNMDSYTSIQVLAVPFHTSMLEV
E.G.Q.S..E..AFSGY.YGD...T........RLWLP.P.VSA.CVDTNPAAFL..Q.SRC.R...L..DCSTLPTLNM.S.TSIQ.LA.........V
Retrocopy
ERGVQMSSAEGSAFSGYQYGDIMVTIXXXXXXXRLWLPSPGVSAHCVDTNPAAFLVEQRSRCSRHLDLRKDCSTLPTLNMASFTSIQMLAGRIDNA--SV


Parental protein
VPMEISSIILQSVEGTQTELMMTAGKDLRPVLLNPSLCANVVLKVAYLMKYTPAGEIVNMALSLVIGFVHETALPLQQEFQIAFVQDEDEATVHYSGNPG
VPME..S.ILQSVEG.Q.EL..TAG..LRP.LLN..LC.NVVLK..Y..KYTPAG.IVN..LSLVIGF.HE.ALPL.QEFQIAFVQDE..ATVHYSGNPG
Retrocopy
VPMEVTSVILQSVEGPQSELQVTAGENLRPRLLNQTLCSNVVLKAVYVVKYTPAGKIVNVMLSLVIGFIHEAALPLLQEFQIAFVQDE--ATVHYSGNPG


Parental protein
YVIGLPLVSGTRTIVFTGIVRSLNPRDTLSVLSSSENQDCLQDPHQRSPILFGVDFVSGCSLRMEEVANCSLVSQTMLSVLRGSNYPQYVASFGNSPLEN
Y..GLPLVSGT.T....GI.RS.NPRDT.SVL.S...QDCL..PHQRSPILFGVDFVSGC.LR.EE..NCSLVSQTML.VLRGSNYPQYVAS.GNSPL..
Retrocopy
YAVGLPLVSGTMTA--DGITRSINPRDTMSVLYSAADQDCLRNPHQRSPILFGVDFVSGCTLRLEENVNCSLVSQTMLRVLRGSNYPQYVASSGNSPLDA


Parental protein
PFDWLPVTSNFNPGETQSCSIPVSFQLEIQWTNYGSLVNPQAQLVSIKEVIQTNKSSLASLSGGSNILPITSSVSFVAVGAAASPGYRAMPTINAKLPAD
P.DWLP..SNF.PG..Q.CSIPVSF.LE..WT.YGSLVNPQAQLVSI.E.IQT..SSLA.LSGG.NI.....SVSFVAV.A.ASP.YRA.PT..A.LP..
Retrocopy
PQDWLPIRSNFHPGGIQGCSIPVSFHLEMKWTKYGSLVNPQAQLVSIQEIIQTGNSSLALLSGGTNIVLVSISVSFVAVSAGASPVYRAKPTVDATLPSN


Parental protein
FFFPFV
FF.P.V
Retrocopy
FFYPLV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide