RetrogeneDB ID:
retro_trub_3
Organism:
Location:
scaffold_99:718888-719893 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
51.16 %
Coverage:
51.2 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
ccdc113 (2 of 2)
Parental gene aliases:
No gene alias available
Parental gene description:
coiled-coil domain containing 113 [Source:ZFIN;Acc:ZDB-GENE-041010-163]

Genomic region (view in browser)





>retro_trub_3
ACATTCAGGAAAATGTCAGAGCCACAATTGGTATCATCAGGTGACTCAACAGACGATGAA
AACCAAAGGATTCAGCTCCACCAACAAGTGGAAGAACTGAGAGGTTTTAATGAAGCACTC
TTGGCAGAGAATGAGATGTTTGAGCAGTTCATCATCCACAGTGATAAACAGAACCAGAAG
TTCAGTGTAGACCCCCAACGGAACGATAAACTTAAAAAGGGTTCTAGCATCCGCTCAATA
TCCCAGTCTCGTGAGCTGACCATTGAGCAAAAACTTTATGTATCAGAGACGGCAATAAAA
GAGGCACAAAAAGATCTGGAGCAACTCAGAGAAAGAAATATGAAAACCTGGGATCACTAT
GTGTCCACCCTGGAAGAAGCAAAGTTGTGTCTTGAAGAAATCAGGAAAGGGAAGAAGGAA
TTTGAGCAAAAACTGCTCAGACGCGCGAATGAAAAAAGGCTGGAGATGAAAGAACCTGAG
AAGTTGCTCCTGTACATTGTCGACAAGTCCAAGACCACTAAAATTGAAATGTTGTCTATA
AAGAACAGTGTATTAAAAGGCCTCAAGAATAAGCTTAAGCATGATTTTCAACAGAAAAAA
GAAAATCTTAAAATCTATTATGAAAAATCTGTCCTTTTCCAAGGGTGGAGTAAGCAGAAA
AGAGAAAAGCCCCTGGGGGAACTTCTAGGTGACTATGTAAAAACGCAGCATGTCATCACT
GTACATAAAGAGAAACAGAAGGGTGTGACAGCCGAACACACAAAGGTTTGCAAAAGGATT
AAAAAGAGGGCGGAATTTCTGGTAAAAACTGAGAATGACATTCAACAGGCGGAACAAGGA
CGTTTGAAGGCAGGAAACCTGAACCGACGCCTGCGCTCTCAGATGGAAAATTATGAGGTC
CCTGAGGTAAAGGAGTACTTAGAAGCCAGGAGGAGATACAAGAAGCTGCAGCAGGATATT
CGAATTTGGGAGAGGAAGGTCAAGATTGCTCAGATGATTTTATAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QKDGRVSTACRRHQLTLEEKLHVSREEIAEAQKDLENLRETNEGTCDAYKASLKEAGLHLEEIRKAKNEFEHKMQERMNDKRLEMKEPEKCLQYLEDKAK
.K............LT.E.KL.VS...I.EAQKDLE.LRE.N..T.D.Y...L.EA.L.LEEIRK.K.EFE.K...R.N.KRLEMKEPEK.L.Y..DK.K
Retrocopy
KKGSSIRSISQSRELTIEQKLYVSETAIKEAQKDLEQLRERNMKTWDHYVSTLEEAKLCLEEIRKGKKEFEQKLLRRANEKRLEMKEPEKLLLYIVDKSK


Parental protein
AAQVEILRLKNGALKVIENKLKHNFHQKREKGKTSYEE--IFQDWGEHKSEKSLDELRANSLEVQRVLTVHK
....E.L..KN..LK...NKLKH.F.QK.E..K..YE....FQ.W...K.EK.L.EL.......Q.V.TVHK
Retrocopy
TTKIEMLSIKNSVLKGLKNKLKHDFQQKKENLKIYYEKSVLFQGWSKQKREKPLGELLGDYVKTQHVITVHK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide