RetrogeneDB ID:
retro_trub_31
Organism:
Location:
scaffold_21:1252959-1253625 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.23 %
Coverage:
83.21 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
TNNT2
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_trub_31
GCTGAAAAGGAAGAGGCTGAGAAGAAAGAGGAGCACGAGGAGTCCAGACCACGGCCGAAG
GCCACATACGTACCAAATATGGCTCCTCCGAAGCTCCCCGATGGAGAGAAGGTGGATTTT
GATGACCTGCATCGTAAGAGGCTGGAGAAGGACTACAACGACCTCCAGACGCTGATCGAG
CTGCATTTCACCACCCGGCAGAAGGAGGAAGAGGAGCTGATCGCCTTACGAACGCGCATA
GAGCGTCGCCGGGCTGACCGGGCAGAGCAGCAGCGCATTCGCACCGAGCAGGAGCGCGAG
CGCCAGACCCGCCTGGCCGGGGAGAAGGCGAGGCGCGAAGAGGAGGCGGCGAAACTGCGC
GCCGAGGAGGAGGCCAAGAAGAAGAAGATCTTCACCAATAAGTCGTTCGGTGGCTACCTG
CAGAAGGTGGATCAGAAGAAGGGCAAGAAGCTGACTGCCAGAGAGGAGAAGAAGAAGATC
CTGATGGATCGGCGGAAGCCCCTGAACATTGACCACCTGAACCAGGAGAAGCTGGAGGAG
AAGGCGCAGGACCTGTGGCAGTGGCTCCACCAGCTGCACGCCGAGAAGTTTGAGCTGGCG
GAGAAGCTGAAGAGGCAGAAGTACGACATCTACGTGCTGCGCAACCGAGTCAGCGACCAC
CAGAGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AEEEEEEDPEHGEEAKPKFKPFIMPNLIPPKIPDGEKVDFDDIHRKRMEKDLMELQTLIEVHFESRKKEEEELIQLKERIENRRAERAEQQRIRSEREKE
AE.EE.E..E..EE..P..K....PN..PPK.PDGEKVDFDD.HRKR.EKD...LQTLIE.HF..R.KEEEELI.L..RIE.RRA.RAEQQRIR.E.E.E
Retrocopy
AEKEEAEKKEEHEESRPRPKATYVPNMAPPKLPDGEKVDFDDLHRKRLEKDYNDLQTLIELHFTTRQKEEEELIALRTRIERRRADRAEQQRIRTEQERE


Parental protein
RQKRLEDERTRKEEEEAKRRAEDDAKKKKTLTSLHFGGYMQKLTEKRSGKRQTEREKKKKILSERRKSLDIDNLNQERLRDKAKELWEWMYQLEAEKFEL
RQ.RL..E..R.EEE.AK.RAE..AKKKK..T...FGGY.QK...K..GK..T.RE.KKKIL..RRK.L.ID.LNQE.L..KA..LW.W..QL.AEKFEL
Retrocopy
RQTRLAGEKARREEEAAKLRAEEEAKKKKIFTNKSFGGYLQKVDQKK-GKKLTAREEKKKILMDRRKPLNIDHLNQEKLEEKAQDLWQWLHQLHAEKFEL


Parental protein
QDQITKQKYEINVLRNRVSDHQK
......QKY.I.VLRNRVSDHQ.
Retrocopy
AEKLKRQKYDIYVLRNRVSDHQR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide