RetrogeneDB ID:
retro_trub_39
Organism:
Location:
scaffold_48:924053-924513 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.84 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
UBE2L3
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_trub_39
ATGTTTGCTATCAGGAGGCTGGCAAAAGAACTTGAGGAGATCCGAAATTCTGGCAAGAAA
AACTTCAGAAACATTCAAGTTGACGACTCAATCCTGTCATGGCAAGGACTCATCGTCCTT
GACAACCCTCCTTATGACAAAGGCGCTTTCAAAATGGAAATAATTTTCCCTGCCGAGTAC
CCATTTAAGCCCCCCAGGATCATCTTCAAGACAAGAATTTACCACCCCAACATTGACGAG
AAGGGCCAGGTATGTCTGCCTGCGACCATGGCAGAGAACTGGATTCCTGTCATCAAACCA
GAAGAAGTAATACATTCCCTCATTGCACTTCTGGACGACCCCCCAGCCAGGACACCCCCT
GAGGACAGATTTAGCAGAAGAATACTTACAAGACCGTAATAAATTCATGAGGAATGCTGA
AGAGTTTACAAAGAAAAATAGCGAAAAGTGTCCACAGGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSASRRLAKELEEIRKSGMKNFRNIQVEESNLLSWQGLIVPDNPPYDKGAFRIEIIFPTEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATK
M.A.RRLAKELEEIR.SG.KNFRNIQV..S..LSWQGLIV.DNPPYDKGAF..EIIFP.EYPFKPP.I.FKT.IYHPNIDEKGQVCLP...AENW.P..K
Retrocopy
MFAIRRLAKELEEIRNSGKKNFRNIQVDDS-ILSWQGLIVLDNPPYDKGAFKMEIIFPAEYPFKPPRIIFKTRIYHPNIDEKGQVCLPATMAENWIPVIK


Parental protein
TDQVIQSLIALVND-PQPEHPLRADLAEEYSKDRKKFLKNAEEFTKKHGEKRPMD
...VI.SLIAL..D.PQP.HPLR.DLAEEY..DR.KF..NAEEFTKK..EK.P.D
Retrocopy
PEEVIHSLIALLDD\PQPGHPLRTDLAEEYLQDRNKFMRNAEEFTKKNSEKCPQD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide