RetrogeneDB ID:
retro_trub_43
Organism:
Location:
scaffold_6206:2232-2679 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.33 %
Coverage:
57.69 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
HOXB6A
Parental gene aliases:
No gene alias available
Parental gene description:
Homeobox protein Hox-B8a [Source:UniProtKB/Swiss-Prot;Acc:Q1KKY1]

Genomic region (view in browser)





>retro_trub_43
ATGTCCATTTCTGGGACTTTGAGCAACTATTACGTGGACTCCATTATAAGTCACGAGAGT
GACGACCTCACAGCGTCCACTCGGTTTCCCAGCGTTCAGTATTCCGGCTCGAGCTCCGCC
GCGGCCGCTAACGGAAGGCAGCCCGGGGGCGCGGTGCACGCCGAGCATCCTCACCCGGAG
CCGTACCCGTCCTGCAGCTTCCAGCCGAAGCCTCCGGTCTTCTCGTCTTCGTGGAGCCCC
TTCAGTCCGCACCACGGTGCCAGCAGCCTGCCGGCCGTCTACCACCCGTATCTCCCCGCG
CAGCACGTCCCCTCCGCGGACACACGCTACCTCCGCTCATGGCTGGACTGCGCGCCGCGC
GGCTCCGAGTCCGTCCAGGGCCACACGGGTCAGGTCAAGCTGGAACCGCAGCTCGGTCAT
CTCGGAGGCGAGATTCCAGCCAAGCTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSISGTLSNYYVDSIISHESDDLTASTRFPSVQYSGSSSAAAANGRQPGGAVHAEHPHPEPYPSCSFQPIRGPWFHFDIDTHSVRASISLFPLQKDPSVE
MSISGTLSNYYVDSIISHESDDLTASTRFPSVQYSGSSSAAAANGRQPGGAVHAEHPHPEPYPSCSFQP...P.F.......S.....S..P....P...
Retrocopy
MSISGTLSNYYVDSIISHESDDLTASTRFPSVQYSGSSSAAAANGRQPGGAVHAEHPHPEPYPSCSFQP-KPPVFSSSWSPFSPHHGASSLPAVYHPYLP


Parental protein
VQPVAEKDTFPIRISVYCSGLSLDVAAFHCVKVSVQPQILLIGKIVPVKL
.Q.V...DT...R....C..........H...V...PQ....G...P.KL
Retrocopy
AQHVPSADTRYLRSWLDCAPRGSESVQGHTGQVKLEPQLGHLGGEIPAKL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide