RetrogeneDB ID:
retro_trub_44
Organism:
Location:
scaffold_623:50530-51508 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.42 %
Coverage:
75.86 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
OPN4
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_trub_44
TTCCCCACCGTGGACGTCCCTGACCATGCTCACTACATCATTGGCTCGGTCATCTTGCTC
GTGGGCCTGACGGGCATGTCGGGAAACGCTCTCGTCATCTACGTCTTCTGCCGCAGCCGC
ACCCTGCGGTCGCCTAGCAACCTGCTGGTGGTGAACCTGGCAGCCGCCGACTTCCTGATG
TCGCTGACGCAGTCCCCGGTGTTCTTCGTGGCCAGCCTGCACCGCCGCTGGTTGTTTGGA
GAGCTGGCCTGTGAACTGTACGCCTTCTGCGGCGCGCTCTTTGGCATCGCCTCTATGATG
ACCCTCACCGCCATCGCCGTGGACCGCTGCCTGGCCATCACGCGGCCGCTGGCCCGGCTG
GGCGGCATGAGTCCCGGGGGGGTGCTGGCGGTGCTGGCGGGCGTGTGGCTGTACTCGCTG
TGCTGGAGTCTGCCGCCGTTCTTTGGGTGGAGTGCTTATGTCCCTGAGGGCCTCCAGACG
TCCTGCAGCTGGGACTACATGAGCTTCACCGCTGCCGTGCGCTCCTACACCATCCTGCTC
TTTGCTTTTGTCTTCTTTGTCCCGCTCGGTCTCATCGCCGGCTGCTACTTCGCCATCTTC
CGGGCGGTGCGGCGTGCGGGTCAGGAGGTGGAGCGGCTGAACTGTGGACAGATGAACAAG
GCGTATGAGCGTCTGCGCAGCGAGTGGCACTTAGCTAAGGTGGCTCTGGGAGTCATCCTG
CTCTTCGTCGTGTCCTGGGCGCCATACTCCGCCGTGGCCCTGACCGCCACTGCGGGCTAC
GCCCACCTGCTGACCCCCTACATGAACTCCGTTCCTGCCGTCATTGCCAAGGCTTCAGCC
ATCCACAACCCCATCATCTACGCCATCACACACCCCAAGTATCGGGCTGCCATTGGCCGA
TGTGTCCCACTGCTGCGTCCTCTGCTGCGTCTCCAGGACAAGGACCTTCGCTCGTCCATC
AGCTCTAGCAGCGCTTTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FPTVDVPDHAHYTIGSVILVIGITGMIGNFLVIYAFCRSRSLRTPANMFIINLAVTDLLMCVTQTPIFFTTSMYKRWIFGEKGCELYAFCGALFGICSMI
FPTVDVPDHAHY.IGSVIL..G.TGM.GN.LVIY.FCRSR.LR.P.N....NLA..D.LM..TQ.P.FF..S...RW.FGE..CELYAFCGALFGI.SM.
Retrocopy
FPTVDVPDHAHYIIGSVILLVGLTGMSGNALVIYVFCRSRTLRSPSNLLVVNLAAADFLMSLTQSPVFFVASLHRRWLFGELACELYAFCGALFGIASMM


Parental protein
TLTVIAIDRYFVITRPLTSIGVLSRKRAFVILMTVWIYSLGWSLPPFFGWSAYVPEGLLTSCTWDYMTFSPSVRAYTMLLFIFVFFLPLFIIIYCYFFIF
TLT.IA.DR...ITRPL...G..S..........VW.YSL.WSLPPFFGWSAYVPEGL.TSC.WDYM.F...VR.YT.LLF.FVFF.PL..I..CYF.IF
Retrocopy
TLTAIAVDRCLAITRPLARLGGMSPGXXXXXXXXVWLYSLCWSLPPFFGWSAYVPEGLQTSCSWDYMSFTAAVRSYTILLFAFVFFVPLGLIAGCYFAIF


Parental protein
RAIRATNKSVGMCMCPHIRRESVKNFQRLQNEWKMAKIALMVILLYVISWSPYSCVALTAFAGYADMLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRL
RA.R.....V....C............RL..EW..AK.AL.VILL.V.SW.PYS.VALTA.AGYA..LTPYMNSVPAVIAKASAIHNPIIYAITHPKYR.
Retrocopy
RAVRRAGQEVERLNCGQMNKA----YERLRSEWHLAKVALGVILLFVVSWAPYSAVALTATAGYAHLLTPYMNSVPAVIAKASAIHNPIIYAITHPKYRA


Parental protein
ALAKYIPCLGFLLCISPHELQSTSSSFMSL
A.....P.L..LL......L.S..SS...L
Retrocopy
AIGRCVPLLRPLLRLQDKDLRSSISSSSAL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide