RetrogeneDB ID:
retro_trub_5
Organism:
Location:
scaffold_268:58542-64344 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
79.89 %
Coverage:
99.9 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
MYHM2126-2
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_trub_5
AAGTCCACCATGAGCGACTCTCTAATGGCTGAATTTGGAAAGGCTGCTCCTTACCTGAGG
AAGTCAGAAAAGGAGCGTCTTGAAGCTCAGACCAGAGCTTTTGACATCAAGATTGAATGC
TTTGTTGTGGATGAGAAGGTGGAATATATGAAGGGACAAATCCAGAGCAAAGATGGAGGG
ATGGTAACGGTCAAAAAGGAGGATGGAGCTACAGTGACTGTTAAAGAGTCAGATGTCCAC
CCCCAGAACCCACCAAAATTTGATAAAATTGAAGACATGGCAATGTTCACCTTCCTCCAT
GAGCCGGCTGTGCTGTTTAACCTCAAAGAGCGTTATGCTGCCTGGATGATCTACACTTAT
TCAGGATTGTTCTGCGTCACAGTCAATCCCTACAAGTGGCTTCCAGTCTATGATGCTGAA
GTGGTGGCAGCTTACAGAGGGAAAAAGCGAACGGAGGCCCCCCCTCATATATTTTCCATC
TCAGATAATGCCTACCAGTACATGCTGACTGACCGGGAGAACCAATCGGTGCTCATCACA
GGAGAATCAGGAGCTGGGAAGACTGTGAACACCAAGAGGGTCATCCAGTACTTTGCCAGC
ATTGCTGCCGTCGGGAGTGGTTGCAGAAAAGATGCCAGTAAAGGGACTCTGGAGGATCAG
ATCATCCAGGCAAATCCCGCCCTGGAGGCTTTCGGCAATGCAAAAACGTTGAGAAATGAC
AATTCTTCAAGATTTGGAAAATTCATACGAATTCATTTTGGTCCAAGTGGCAAACTCTCC
TCTGCTGACATTGAGACGTATCTACTGGAGAAGTCGCGAGTCACCTTTCAGCTGAAAGCT
GAGAGAAATTATCACATCTTTTATCAGATCTTGTCCAATCAAAAGCCAGAGCTTCTGGAC
ATGTTACTTATCACCAACAACCCATACGACTACTCCTACATCTCCCAAGGAGAGGTGACG
GTTGCCTCCATCAATGACTCAGAAGAGCTGATGGCCACTGATAGTGCCTTTGATGTTCTG
GGCTTCACTCCAGAAGAGAAGATGGGGGTTTACAAACTGACGGGTGCAATCATGCACTAT
GGTAACATGAAGTTCAAGCAGAAGCAACGTGAAGAGCAGGCTGAGCCAGATGGGACAGAA
GCTGCGGATAAGTCATCTTATCTCATGGGACTGAATTCCGCGGACCTCATCAAGGGGCTG
TGCCACCCCCGAGTCAAAGTAGGAAATGAATATGTCACCAAAGGCCAAAGCGTGGACCAA
GTCTACTATGCCCTCGGTGCTCTTGCCAAATCGGTATATGAAAAGATGTTCAACTGGATG
GTGGTGAGAATCAACCAATCCCTTGACACAAAACAGCACAGGCAGTACTTCATAGGAGTG
CTGGACATTGCAGGATTTGAGATCTTTGATTATAACACCTTTGAGCAGCTCTGCATCAAC
TTTACCAATGAAAAACTGCAACAGTTTTTTAACCATCACATGTTTGTTCTTGAGCAAGAA
GAGTACAAAAAAGAGGGTATCGACTGGGAGTTCATCGATTTTGGGATGGACCTGCAAGCT
TGTATTGACCTCATCGAAAAGCCACTGGGAATTCTTTCAATTCTGGAGGAGGAGTGCATG
TTCCCCAAAGCCAGTGACCAGACCTTCAAGTCCAAGCTCTATGATAATCATTTGGGAAAG
AACAAAATGTTTGAAAAACCACGAGCAGCAAAGGGGAAAGCAGAGGCTCACTTTGCCCTG
GTTCACTATGCAGGAACAGTGGACTACAACATCACCAACTGGCTGGTGAAGAACAAAGAC
CCTCTAAATGAAACCGTGGTTGGTCTTTACCAGAAGTCGTCCCTGAAACTACTCAGTGTG
CTGTTTTCAACCTTCTCATCTGACAGCAGTGACAAAGGAGGCAAAGGGGCCAAGAAGAAA
GGTTCCTCCTTCCAAACTGTGTCTGCGCTTCACAGGGAAAATCTAAACAAGCTGATGACC
AACCTAAAGACAACGCACCCCCACTTTGTACGCTGTCTGATTCCCAATGAGCGGAAAACC
CCAGGGGTCATGGACAACTGCCTTGTCATGCACCAGCTGCGCTGTAACGGAGTTCTGGAA
GGCATCCGGATCTGCAGAAAGGGCTTCCCTAATAGAGTTCTGTATGGCGACTTTAAACAA
CGCTACAGGATCCTGAATGCCTCTGCCATCCCTGAAGGGCAGTTCATTGACTGCAAGAAG
AGTGCTGAAAAGTTACTGGGATCTCTGGACATTGATCATACACAGTACAGGTTTGGCCAC
ACAAAGGTCTTCTTTAAGGCTGGTTTACTAGGTACACTCGAGGAGATGAGAGATGAACAA
CTCTCTCGGATCCTCACCAGGATCCAGGCTAATGCCCGGGGAATCCTAATGAGGGTGCAG
TTTGCTAAGCTGCTGGAACGCAGAGATGCTCTTATGGTCATCCAATGGAACCTTCGCTCT
TTCTTGGGCGTGAAGAACTGGCCCTGGATGAAGCTTTTCTTCAAGATCAAGCCCCTGTTA
AAGAGTGCTGAGGCTGAGAAGGAAATGGCCAGCATGAAAGATGAGTTCAACAAGTTGAAA
GAAGCTTTGGAAAAATCAGAAACCAGGCGGAAAGAACTGGAGGAGAAAATAGTTACTCTT
CTCCAAGAGAAGAATGACCTGACTCTGCAGATTCAGTCTGAACAGGATACGCTAACAGAT
GCCGAAGAACGCTGCGAACAGCTGATAAAGAGCAAAATTCAACTGGAGGCCAAGCTCAAG
GAAATTACAGAGAGGCTTGAAGATGAGGAGGAGATCAATGCAGATCTCACTGCTAAGAAA
CGGAAGCTCGAAGATGAATGTTCCGAGTTAAAGAAAGATATAGATGACCTGGAGCTGACT
CTGGCAAAGGTTGAGAAAGAAAAGCATGCAACAGAAAATAAGGTGAAAAATCTGACAGAG
GAGATGGCTTCGCAGGATGACAACATCATGAAACTAACCAAAGAGAAGAAGGCACTGCAG
GAAGTTCACCAGCAAACACTGGATGATCTTCAGAGTGAAGAAGACAAAGCCAACAGTTTG
ACCAAAGCCAAAGCCAAGCTCGAACAACAAGTGGATGATCTGGAGGGCTCACTGGAGCAG
GAGAAGAAAGTCAGAATGGACATTGAGCGATCAAAGAGGAAGCTTGAAGGAGACTTTAAG
CTGATGCAAGAGAGCTTGATGGACCTGGAAAATGATAAACAGCAGCTGGAGGAAAAATTA
AAGAAGAAAGACTTTGAAACTGTCCAAATGAATTCAAGACTAGAAGATGAGCAAGTTTCC
ACAAATCAGCTCCATAAAAAGGTAAAAGAGAGTCAGGCAAGAATTGAAGAACTGGAGGAA
GAGCTGGATGCTGAGCGTGCAGCTCGAGCCAAGGTTGAGAAACAGCGCTCTGATCTTTCT
CGCGAGCTCGAGGACATCAGCGAGCGCCTTGAGGAGGCTGGAGGAGCAACATCCGCACAA
GTAGAGTTAAACAAAAAGAGGGACTCTGAATTTCAGAAGCTGCGGCGAGAACTGGAGGAA
TCTACACTCCAACACGAGTCTACTGCCGCCTCCCTCAGGAAGAAACACGCCGACAGTGTT
GCTGAGCTCGGTGAGCAAATCGATAACTTACAGCGGGTGAAGCAGAAGCTGGAGAAAGAG
AAGAGTGAGCTGAAACTGGAATTGGATGACCTGTGCTCCAACATGGAGACTGTAATTAAG
GCCAAGTCTAATATGGAGAAGATGTGTCGTGCGATGGAAGACAGCATGAACGAATACAAA
AACAAACAGGATGAAGCTCAAAGGGCCATCAGTGACCTGACTACACAGAGGGCCAAGTTT
CTCACCGAGAATGGCGAGCTTGGCCGTCGACTAGAGGAGAAGGAATGTCTGATATCACAG
CTGACCAGAGCAAAGATGTCCTACAACCAGCAGGTCGAAGATCTTCGTCGACAACTGGAA
GAAGAAGTCAAGGCAAAAAATGCTCTAGCGCATGCTGTCCAGTCGGCTCGTCATGACTGT
GATCTGCTCCGAGAGCAGTTTGAGGAGGAGCAAGAGGCAAAAGCTGAGTTGCAACGAGCT
CTTTCCAAATCCAACACTGAGGTCTCAACATGGAGGACAAAATATGAGTCTGATGGAATC
CAGCGAATGGAGGAACTAGAAGAAGCAAAAAAGAAATTGGTTCAGAGACTTCAGGAGGCT
GAGGAGGCCATCGAGGCTGTGAATGCGAAGTGTTCCTCTCTGGAGAAAACCAAACATCGT
CTCCAAAATGAGATAGAAGACCTGATGCTGGACCTGGAGAGAGCCAATGCAGCATCTGCA
GCACTCGATAAGAAGCAGCGATCGTTTGACAAAATCATGGCTGAGTGGAAGCAGAAGTTT
GAGGAGTCTCAGTGTGAGCTGGAGGCCTCCCAGAAGGAGGCTCGTTCTCTGAGCACTGAA
CTCTTCAAACTGAAGAATGCCTATGAAGAGTGTCTTGAGCAACTTGAGACAACAAAGAGA
GAGAACAAGAACCTCCAGGAAGAGATTTCTGACCTCACTGACCAGCTTGGGGAAGGTGGT
AGGAGTGCTCATGAGCTGGACAAAATGCGGAAACAGCTCGAACAAGAAAAATCAGAGCTT
CAGACCGCACTGGAGGAGGCTGAGGGGTCTCTGGAGCATGAAGAGAGCAAGATCCTTCGA
TCTCAGCTGGAATTCAACCAAGTGAAGGCTGACATGGAGCGCAAGCTGTCAGAAAAAGAT
GAAGAGATGGAGCAGGCCAAGAGGAACTACCAGCGCATGCTTGATTCACTTCAGTCCTCA
CTGGAATCTGAAACGAGGAGCCGCAATGAGGCCTTGAGACTAAAGAAGAAGATGGAGGGT
GATCTCAACGAGATGGAAATCCAGCTAAGCCAAGCAAACAGACAGGCAGCTGATGCCCAG
AAACAAATCAAGAACCTCCAGACCTTTATGAAGGATCTTCAGATGCAGCTTGATGATGCT
CATCATGCTAATGATGATATGAGAGAGAACACTGCTCTCCTGGAACGCAGACACAATCTA
ATCCAGGCCGAGCTTGAGGAGGTCCGAGCTGCCTTTGAGCAGACGGAGAGAACCCGCAAG
CTGGCAGAGCAGGAGCTGACTGATATCACTGAGCGCATGCAACTCTTGCACTCCCAGAAC
ACCAGCCTGCTCAACCAGAAGAAGAAGCATGAAGCTGACCTGCTGCAACTCCAGACAGAG
ACGGAAGAGGCCATCCAAGAAAATCGCAATGCCGAGGAGAAAGCCAAGAAAGCCATCAAT
GATGCTGCCATGATGGCTGAGGAACTGAAGAAGGAGCAGGACACCAGTGCCCACCTGGAG
CGCATGAAAAAAAACATGGAGCAAACCATCAAAGACCTTCAGCATCGGCTGGATGAGGCT
GAGCAGGTGGCCATGAAGGGTGGCAAGAAGCAGCTACAGAAGCTGGAGACTCGCATCAAA
GAGCTGGAGAGTGAACTGGAGGCGGAGCAAAGAAAGGGAATAGAGTCCATCAAGGGGATC
CGCAAATATGAGCGACGCCTCAAGGAGCTCACCTACCAGACTGAAGAGGACCGCAAGAAC
ATGGCCCGCCTCCAGGAACTGGTAGACAAGCTGCAGCTGAAAGTCAAGTCCTATAAACGA
GCCGCGGAGGAGGCTGAGGAGGCGGGAAACGCCAACATGGCTAAACTTCGCAAACTGCAG
CATGAGCTGGAGGAGGCCGAGGAGAGGGCTGACATTGCTGAGTCCCAGGTGAATAAGCTG
AAGGCCAAAACCCGGGACGGTTCCACCAAGAAGGGCCTGGAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGDAQMATFGAAAPYLRKSERERMEASTRAFDIKKECFVPDPVQEFVKATVISREGDKVTVETEHGKTVTFKDTQILQQNPPKFNMIEDMAMLTFLHEPA
M.D..MA.FG.AAPYLRKSE.ER.EA.TRAFDIK.ECFV.D...E..K....S..G..VTV..E.G.TVT.K......QNPPKF..IEDMAM.TFLHEPA
Retrocopy
MSDSLMAEFGKAAPYLRKSEKERLEAQTRAFDIKIECFVVDEKVEYMKGQIQSKDGGMVTVKKEDGATVTVKESDVHPQNPPKFDKIEDMAMFTFLHEPA


Parental protein
VLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVVAYRGKKRSEAPPHIFSISDNAYQYMLADRENQSILITGESGAGKTVNTKRVIQYFASIAA
VLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVY..EVV.AYRGKKR.EAPPHIFSISDNAYQYML.DRENQS.LITGESGAGKTVNTKRVIQYFASIAA
Retrocopy
VLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYDAEVVAAYRGKKRTEAPPHIFSISDNAYQYMLTDRENQSVLITGESGAGKTVNTKRVIQYFASIAA


Parental protein
--GGVKKDSTTKDKGTLEDQIIQANPALEAFGNAKTIRNDNSSRFGKFIRIHFDTRGKLASADIETYLLEKSRVTFQLKAERDYHIFYQILSNKKPEILE
...G..KD.....KGTLEDQIIQANPALEAFGNAKT.RNDNSSRFGKFIRIHF...GKL.SADIETYLLEKSRVTFQLKAER.YHIFYQILSN.KPE.L.
Retrocopy
VGSGCRKDAS---KGTLEDQIIQANPALEAFGNAKTLRNDNSSRFGKFIRIHFGPSGKLSSADIETYLLEKSRVTFQLKAERNYHIFYQILSNQKPELLD


Parental protein
MLLITNNPYDYAFISQGETQVASIDDAEELMATDSAFDVLGFTQEEKNSVYKLTGAIMHYGNMRFKQRQREEQADADGTEDADKSAYLMGLNSADLIKGL
MLLITNNPYDY..ISQGE..VASI.D.EELMATDSAFDVLGFT.EEK..VYKLTGAIMHYGNM.FKQ.QREEQA..DGTE.ADKS.YLMGLNSADLIKGL
Retrocopy
MLLITNNPYDYSYISQGEVTVASINDSEELMATDSAFDVLGFTPEEKMGVYKLTGAIMHYGNMKFKQKQREEQAEPDGTEAADKSSYLMGLNSADLIKGL


Parental protein
CHPRVKVGNEWVTKGQNVAQVNYAVGALSKAVYEKMFLWMVVRINQSLETRQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQE
CHPRVKVGNE.VTKGQ.V.QV.YA.GAL.K.VYEKMF.WMVVRINQSL.T.Q.RQYFIGVLDIAGFEIFD.NTFEQLCINFTNEKLQQFFNHHMFVLEQE
Retrocopy
CHPRVKVGNEYVTKGQSVDQVYYALGALAKSVYEKMFNWMVVRINQSLDTKQHRQYFIGVLDIAGFEIFDYNTFEQLCINFTNEKLQQFFNHHMFVLEQE


Parental protein
EYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDATFKAKLYDNHLGKSANFQKPRIVKGKPEAHFALMHYAGTVDYNINNWLVKNKD
EYKKEGI.W.FIDFGMDLQACIDLIEKP.GI.SILEEECMFPKASD.TFK.KLYDNHLGK...F.KPR..KGK.EAHFAL.HYAGTVDYNI.NWLVKNKD
Retrocopy
EYKKEGIDWEFIDFGMDLQACIDLIEKPLGILSILEEECMFPKASDQTFKSKLYDNHLGKNKMFEKPRAAKGKAEAHFALVHYAGTVDYNITNWLVKNKD


Parental protein
PLNETVVALYQKSNLKLLSILFANYSGADAAMTEGTEGKKEKKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMENPLVMHQLRC
PLNETVV.LYQKS.LKLLS.LF...S........G..G.K.K...GSSFQTVSALHRENLNKLMTNL..THPHFVRC.IPNE.KTPG.M.N.LVMHQLRC
Retrocopy
PLNETVVGLYQKSSLKLLSVLFSTFSSDSS--DKGGKGAKKK---GSSFQTVSALHRENLNKLMTNLKTTHPHFVRCLIPNERKTPGVMDNCLVMHQLRC


Parental protein
NGVLEGIRICRKGFPNRILYGDFKQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSKIITAIQARSRGL
NGVLEGIRICRKGFPNR.LYGDFKQRYRILN..AIPEGQFID..K.AEKLLGSLDIDH.QY.FGHTKVFFKAGLLG.LEEMRDE.LS.I.T.IQA..RG.
Retrocopy
NGVLEGIRICRKGFPNRVLYGDFKQRYRILNASAIPEGQFIDCKKSAEKLLGSLDIDHTQYRFGHTKVFFKAGLLGTLEEMRDEQLSRILTRIQANARGI


Parental protein
LSRIEYQKIVERRDALLVIQWNVRAFMGVKNWPWMKLYFKIKPLLRSAEAEKEMANMKEEFLKLKEAFAKSEARRKELEEKMVTLLQEKNDLQLQVQAEQ
L.R....K..ERRDAL.VIQWN.R.F.GVKNWPWMKL.FKIKPLL.SAEAEKEMA.MK.EF.KLKEA..KSE.RRKELEEK.VTLLQEKNDL.LQ.Q.EQ
Retrocopy
LMRVQFAKLLERRDALMVIQWNLRSFLGVKNWPWMKLFFKIKPLLKSAEAEKEMASMKDEFNKLKEALEKSETRRKELEEKIVTLLQEKNDLTLQIQSEQ


Parental protein
DNLCDAEERCEGLIKNKIQLEAKSKELTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDEIIAKLTKE
D.L.DAEERCE.LIK.KIQLEAK.KE.TERLEDEEE.NA.LTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMA..D..I.KLTKE
Retrocopy
DTLTDAEERCEQLIKSKIQLEAKLKEITERLEDEEEINADLTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMASQDDNIMKLTKE


Parental protein
KKALQEAHQQTLDDLQSEEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLTQETVMDLENDKQQLEERLKKKDFEISQLNGKIE
KKALQE.HQQTLDDLQSEEDK.N.LTKAK.KLEQQVDDLEGSLEQEKK.RMD.ER.KRKLEGD.KL.QE..MDLENDKQQLEE.LKKKDFE..Q.N...E
Retrocopy
KKALQEVHQQTLDDLQSEEDKANSLTKAKAKLEQQVDDLEGSLEQEKKVRMDIERSKRKLEGDFKLMQESLMDLENDKQQLEEKLKKKDFETVQMNSRLE


Parental protein
DEQAIIIQLQKKLKELQARVEELEEELEAERAARAKVEKQRADLARELEEISERLEEAGGATTLQIEMNKKREAEFLKLRRDLEEATLQHEATAAALRKK
DEQ....QL.KK.KE.QAR.EELEEEL.AERAARAKVEKQR.DL.RELE.ISERLEEAGGAT..Q.E.NKKR..EF.KLRR.LEE.TLQHE.TAA.LRKK
Retrocopy
DEQVSTNQLHKKVKESQARIEELEEELDAERAARAKVEKQRSDLSRELEDISERLEEAGGATSAQVELNKKRDSEFQKLRRELEESTLQHESTAASLRKK


Parental protein
QADSVADLGEQIDNLQRVKQKLEKEKSELRLELDDVVSNMEQIVKSKTNLEKTCRTLEDQMNDYRSKCDEYQRTIHDFTTQKAKLQAENDEFTRQADDKE
.ADSVA.LGEQIDNLQRVKQKLEKEKSEL.LELDD..SNME...K.K.N.EK.CR..ED.MN.Y..K.DE.QR.I.D.TTQ.AK...EN.E..R....KE
Retrocopy
HADSVAELGEQIDNLQRVKQKLEKEKSELKLELDDLCSNMETVIKAKSNMEKMCRAMEDSMNEYKNKQDEAQRAISDLTTQRAKFLTENGELGRRLEEKE


Parental protein
SLISQLTRGKNSYTQQLEDIKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEEQEAKAELQRSMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQ
.LISQLTR.K.SY.QQ.ED..RQLEEEVKAKNALAHA.QSARHDCDLLREQ.EEEQEAKAELQR..SK.N.EV..WRTKYE.D.IQR.EELEEAKKKL.Q
Retrocopy
CLISQLTRAKMSYNQQVEDLRRQLEEEVKAKNALAHAVQSARHDCDLLREQFEEEQEAKAELQRALSKSNTEVSTWRTKYESDGIQRMEELEEAKKKLVQ


Parental protein
RLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKVLAEWKQKYEECQCELESSQKEARSLSTELFKLKNSYEESLDQL
RLQEAEEA.EAVNAKCSSLEKTKHRLQNEIEDLM.D.ER.NAA.AALDKKQR.FDK..AEWKQK.EE.QCELE.SQKEARSLSTELFKLKN.YEE.L.QL
Retrocopy
RLQEAEEAIEAVNAKCSSLEKTKHRLQNEIEDLMLDLERANAASAALDKKQRSFDKIMAEWKQKFEESQCELEASQKEARSLSTELFKLKNAYEECLEQL


Parental protein
ETVKRENKILQEEISDLTEQLGEGGKTIHELEKVRKQLEQEKTEIQSALEEAEASLEHEEGKILRAQLEFTQIKAEMERKLAEKDEEMEQSKRNLQRTID
ET.KRENK.LQEEISDLT.QLGEGG...HEL.K.RKQLEQEK.E.Q.ALEEAE.SLEHEE.KILR.QLEF.Q.KA.MERKL.EKDEEMEQ.KRN.QR..D
Retrocopy
ETTKRENKNLQEEISDLTDQLGEGGRSAHELDKMRKQLEQEKSELQTALEEAEGSLEHEESKILRSQLEFNQVKADMERKLSEKDEEMEQAKRNYQRMLD


Parental protein
TLQSSLEAECRSRNEALRLKKKMEGDLNEMEIQLSQANRQAAEAQKQLKSVHAHLKDCQIQLDESMRANDEMKENIAIVERRNNLLQAEVEELRAALEQT
.LQSSLE.E.RSRNEALRLKKKMEGDLNEMEIQLSQANRQAA.AQKQ.K......KD.Q.QLD....AND.M.EN.A..ERR.NL.QAE.EE.RAA.EQT
Retrocopy
SLQSSLESETRSRNEALRLKKKMEGDLNEMEIQLSQANRQAADAQKQIKNLQTFMKDLQMQLDDAHHANDDMRENTALLERRHNLIQAELEEVRAAFEQT


Parental protein
ERSRKLAEQELLDVSERVQLLHSQNTALINQKKKLEVDASQLQTEVEEAVQECRNAEDKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQH
ER.RKLAEQEL.D..ER.QLLHSQNT.L.NQKKK.E.D..QLQTE.EEA.QE.RNAE.KAKKAI.DAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQH
Retrocopy
ERTRKLAEQELTDITERMQLLHSQNTSLLNQKKKHEADLLQLQTETEEAIQENRNAEEKAKKAINDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQH


Parental protein
RLDEAEQIAMKGGKKQVQKLEARVRELENEVESEQKKSTEAAKGIRKYERRIKELTYQTEEDRKNVARLQDLVDKLQLKIKSYKRVAEEAEEQANVHLGK
RLDEAEQ.AMKGGKKQ.QKLE.R..ELE.E.E.EQ.K..E..KGIRKYERR.KELTYQTEEDRKN.ARLQ.LVDKLQLK.KSYKR.AEEAEE..N....K
Retrocopy
RLDEAEQVAMKGGKKQLQKLETRIKELESELEAEQRKGIESIKGIRKYERRLKELTYQTEEDRKNMARLQELVDKLQLKVKSYKRAAEEAEEAGNANMAK


Parental protein
FRKLQHELDEAEERADIAESQVNKLRIKSRDTGSKKGFD
.RKLQHEL.EAEERADIAESQVNKL..K.RD...KKG.D
Retrocopy
LRKLQHELEEAEERADIAESQVNKLKAKTRDGSTKKGLD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide