RetrogeneDB ID:
retro_trub_8
Organism:
Location:
scaffold_264:187282-188614 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.04 %
Coverage:
67.48 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
SFPQ
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_trub_8
ATGCAAGGAAACCGAGGCCCCCAGCAGAACCATGGCCCCAACCGTTCAGCGGAGCAGAAG
AAGCCCGGGGGGACAAACACGAACGGGCAGCAGCCCGACTCCAGCGAGCAGAACAACTCC
AATGAGGCCTTAACCCTGGACCTGCAAAGCTTCAGGAAGCCCGGGGAGAAGACGTTTACG
CAGCGGAGCCGGCTGTTCGTTGGGAACCTGCCCACCGGAGTGGCCGAGGAGGATCTGGAG
AGGCTGTTCGCCAAATACGGGAAGGCCAGTGAGATTTTCATCAACAAGGACCGGGGCTTC
GGCTTCATTCGCCTGGAGACTCGGATCATCGCAGAGATCGCCAGAGCAGAGCTGGATGAC
ACCCCGTTCCGTGGCAGGCCCATCCGAGTCCGGTTCGCCACGCACGGCGCTGCATTGACT
GTGAAAAACCTGCCAGAGTTTGTGTCCAACGAGTTGCTGGAGGAGGCCTTCGCTGTCTTT
GGCCAGATCGAAAGAGCTGTGGTGGTGGTGGACGACCGAGGGCGGCCCACGGGGAAGGGC
ATCGTGGAGTACACCTCCAAACCCGCCGCCAGGAAGGCTCTGGACAAGTGCAACGATGGG
TCCTACCTGCTCACAGCCTTCCCTCGGCCCGTTACCGTGGAGCCCATGGATCAACTCGAC
GACGATGAAGGACTACCAGAGAAGCTGGTTAACAAAAACCAACAGTACCACAAAGAACGC
GAACAGCCGCCCCGGTTTGCGCAGCCCGGCACCTTCGAGTACGAGTACGCGATGCGCTGG
AAGGCTCTGATGGAGATGGAGAAGCAGCAGTACGAGATGGTGGATCGCAACATGAAGGAG
GCTCAGGAGAAGCTGGAGGCGGAGATGGAGGCGGCCCGGCACGAGCATCAAGTGATGCTG
ATGAGGCAGGACCTGTTGAGGAGGCAGGAGGAGCTGCGCAGGATGGAGGAGCTCCACAAC
CAGGAGGTGCAGAAGAGGAAGCAGGCCGAGCTTCGGCAGGAAGAGGAGCGCCGCCGGAGG
GAGGAGGAGATGAGGCTGCGCAACGAAGAGATGATGAAGAGGCAGCAAGAGGGCTTCAGG
GCGAACTTCTCTGAGAACAGAGAGCAGGATCTGCGGATGCACATGGGCAGTCACGGGATG
CCCATGAACAGGAACAATCTGGCCGCCGCCGCCGGTGCCGCCGCCGCCCCAGGCATGGCT
TCGGAGAACGCTGCCATCATGTCGGGGCCCGGAAACAACAGTATTCCCGGTGGAGGCCAG
GGGGTCTTCCCCAGAGGGGTCCCCGGGCCTGGAGACTACGGGTCTGGGCCCAACAAGCAG
CGCAGATTTTGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QGQRSGQQQGQKTAPMAMKRADGQETMDNPAAQAEGSQAKE-FKATLSMLLKPGEKRYTQRCRLFIGNLPNDITEEAFKKLFAKYGEPSEVFINKGKGFG
QG.R..QQ..........K...G..T........E.....E.....L....KPGEK..TQR.RLF.GNLP....EE....LFAKYG..SE.FINK..GFG
Retrocopy
QGNRGPQQNHGPNRSAEQKKPGGTNTNGQQPDSSEQNNSNEALTLDLQSFRKPGEKTFTQRSRLFVGNLPTGVAEEDLERLFAKYGKASEIFINKDRGFG


Parental protein
FIRLESRALAEIAKAELDDTPMKGRPLRVRFATHSAALSVKNLSPFVSNELLEEAFSQFGMVERAVVIVDDRGRSTGKGIVEFASKPAARKALDRCSEGV
FIRLE.R..AEIA.AELDDTP..GRP.RVRFATH.AAL.VKNL..FVSNELLEEAF..FG..ERAVV.VDDRGR.TGKGIVE..SKPAARKALD.C..G.
Retrocopy
FIRLETRIIAEIARAELDDTPFRGRPIRVRFATHGAALTVKNLPEFVSNELLEEAFAVFGQIERAVVVVDDRGRPTGKGIVEYTSKPAARKALDKCNDGS


Parental protein
FLLTCSPRPVVVEPLEQFDDEDGLPEKLAQKNPRYQAEREEPPRFARPGTFEFEYAKRWKSLDEMEKQQRQQVEKNMQEAREKLEAEMEDAYHEHQANLL
.LLT..PRPV.VEP..Q.DD..GLPEKL..KN..Y..ERE.PPRFA.PGTFE.EYA.RWK.L.EMEKQQ...V..NM.EA.EKLEAEME.A.HEHQ..L.
Retrocopy
YLLTAFPRPVTVEPMDQLDDDEGLPEKLVNKNQQYHKEREQPPRFAQPGTFEYEYAMRWKALMEMEKQQYEMVDRNMKEAQEKLEAEMEAARHEHQVMLM


Parental protein
RQDLLRRQEELRRMEELHSQEMQKRKELQLRQEEERRRREEEMLRKREMEEQMRRQREENYRMGGFMDREREMRMNSGG-AMGLGDMSFGAAGQKFPMGG
RQDLLRRQEELRRMEELH.QE.QKRK...LRQEEERRRREEEM...R...E.M.....E..R......RE...RM..G...M........AA.......G
Retrocopy
RQDLLRRQEELRRMEELHNQEVQKRKQAELRQEEERRRREEEM---RLRNEEMMKRQQEGFRANFSENREQDLRMHMGSHGMPMNRNNLAAAAGAAAAPG


Parental protein
LGFEGQQGMGSSPGN
...E....M.S.PGN
Retrocopy
MASENAAIM-SGPGN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide