RetrogeneDB ID:
retro_trub_9
Organism:
Location:
scaffold_399:66454-67597 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
81.58 %
Coverage:
98.96 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
b4galt6 (1 of 2)
Parental gene aliases:
No gene alias available
Parental gene description:
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6 [Source:ZFIN;Acc:ZDB-GENE-040426-789]

Genomic region (view in browser)





>retro_trub_9
ATGGTTTACGTGAGGCGGCTGTTGGGAATCTCTAAACGAACTTTTCTGGCCTTGATATTC
TTCCTAATCTCCAGCGCGTGTCTCTACTTAATTTACGTGGCGCCTGGAATAGCCAACACA
TTGTTGTACGTGGTGCAAGCTCGAGGCATTGTGTTGAGGGACAACGTGAGGACCATTGAG
CAAATGATGCGATTGTACATCAACAAGAACACAACATTTAACTGGACAAATGATCCTGCG
GGAAGGAGCGCCAGTGGATATCTGATGCAGCCAACCACCTACCTTCCAGAGAACTTCACC
TACAGCCAGAACCTGCCCTGCCCACAGCGTTTACCCTCCATGAAGGGCCACAGAGATGTA
AACGTGGCAGAGATTTCCATGGAGGAGACAGAAGTCAGCTTTACCAAATTCGCTGACATG
GAGTTTGGAGGTCATTGGAAACCAAAGGACTGCATACCTCGCTGGAAAGTGGCCATTCTG
ATTCCGTTCAGAAACCGCCACGAGCATCTCCCCATCCTCTTGCAGCACCTCATTCCCATG
CTGCTGCGGCAGAGATTGGAGTTCGGCTTCTATGTCATTGAGCAGAGTGGGAGCCAGCCC
TTCAACAGAGCCATGTTGTTCAATATCGGCTTTTTGGAGGCCATGAAGGACTTGGACTGG
GACTGTTTGATCTTCCATGACGTAGACCACATCCCAGAAAATGACCGAAACTACTACGGC
TGCGGGCAGATGCCACGCCATTTCTCTGCCAAACTGGACAAATACATGTATATTCTTCCA
TACAATGAATTCTTTGGAGGTGTAAGCGGACTCACTGTGGAGCAGTTCCGCAGGATTAAC
GGCTTTCCCAATACATTCTGGGGCTGGGGGGGGGAGGATGATGACTTATGGAAGAGGGTT
CACTACGCTGGTCTGAAAGTCACACGACCCGAAGGCGATATTGGCAAATACAAATCCATT
CCTCACCACCACAGAGGGGAGGTGCAGTTTCTTGGGAGGTATAAACTGCTGAGGTACTCC
AAAGAGCGCCAATACTTGGATGGCCTTAACAATCTTCATTATAGCCCCCGTGTGTCCCTC
AGAAGACTCTACAAAAACATCACGGTGGACCTGCACCCTGAACTGGTCCCACTGAAGAGT
AAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MVNWRRLPRMSNRSFLAFMFFFSMSTTCLYFIYVAPGIANTYFFMVQAQGIMLRDNVRTIGQMIRLYTNKNSTLNGTDYPDGSNSSEYLVQPTTYLPENF
MV..RRL...S.R.FLA..FF...S..CLY.IYVAPGIANT....VQA.GI.LRDNVRTI.QM.RLY.NKN.T.N.T..P.G...S.YL.QPTTYLPENF
Retrocopy
MVYVRRLLGISKRTFLALIFFL-ISSACLYLIYVAPGIANTLLYVVQARGIVLRDNVRTIEQMMRLYINKNTTFNWTNDPAGRSASGYLMQPTTYLPENF


Parental protein
TYAQNLPCPQRLPSMKGLIDVNMTEIPMEETELKFTKFFDIEFGGHWKPKDCVPHWKVAILIPFRNRHEHLPILFQHLLPMLQRQRLQFAFYVIEQSGSQ
TY.QNLPCPQRLPSMKG..DVN..EI.MEETE..FTKF.D.EFGGHWKPKDC.P.WKVAILIPFRNRHEHLPIL.QHL.PML.RQRL.F.FYVIEQSGSQ
Retrocopy
TYSQNLPCPQRLPSMKGHRDVNVAEISMEETEVSFTKFADMEFGGHWKPKDCIPRWKVAILIPFRNRHEHLPILLQHLIPMLLRQRLEFGFYVIEQSGSQ


Parental protein
PFNRAMLFNVGFLEAMKDLDWDCVIFHDVDHIPENDRNYYGCGQMPRHFAAKLDKYMYILPYNEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNR
PFNRAMLFN.GFLEAMKDLDWDC.IFHDVDHIPENDRNYYGCGQMPRHF.AKLDKYMYILPYNEFFGGVSGLTVEQFR.INGFPN.FWGWGGEDDDLW.R
Retrocopy
PFNRAMLFNIGFLEAMKDLDWDCLIFHDVDHIPENDRNYYGCGQMPRHFSAKLDKYMYILPYNEFFGGVSGLTVEQFRRINGFPNTFWGWGGEDDDLWKR


Parental protein
VHYAGLNVTRPEGEIGKYKSIPHHHRGEVQFLGRYKLLRYSKERQHLDGLNNLRYSPTISLSSLYKNISVDLHPELAPIE
VHYAGL.VTRPEG.IGKYKSIPHHHRGEVQFLGRYKLLRYSKERQ.LDGLNNL.YSP..SL..LYKNI.VDLHPEL.P..
Retrocopy
VHYAGLKVTRPEGDIGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYLDGLNNLHYSPRVSLRRLYKNITVDLHPELVPLK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide